Toggle navigation
Browse PrenDB
Predict
Concept
Curate Enzyme PTDBENZ00006
Name
*
Organism
*
Protein sequence
>sp|Q50EL0|DMAW_ASPFU Tryptophan dimethylallyltransferase OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=fgaPT2 PE=1 SV=2 MKAANASSAEAYRVLSRAFRFDNEDQKLWWHSTAPMFAKMLETANYTTPCQYQYLITYKE CVIPSLGCYPTNSAPRWLSILTRYGTPFELSLNCSNSIVRYTFEPINQHTGTDKDPFNTH AIWESLQHLLPLEKSIDLEWFRHFKHDLTLNSEESAFLAHNDRLVGGTIRTQNKLALDLK DGRFALKTYIYPALKAVVTGKTIHELVFGSVRRLAVREPRILPPLNMLEEYIRSRGSKST ASPRLVSCDLTSPAKSRIKIYLLEQMVSLEAMEDLWTLGGRRRDASTLEGLSLVRELWDL IQLSPGLKSYPAPYLPLGVIPDERLPLMANFTLHQNDPVPEPQVYFTTFGMNDMAVADAL TTFFERRGWSEMARTYETTLKSYYPHADHDKLNYLHAYISFSYRDRTPYLSVYLQSFETG DWAVANLSESKVKCQDAACQPTSLPPDLSKTGVYYSGLH
UNIPROTKB
Gene
*
PDB codes
Reference
*
-
Breaking the regioselectivity of indole prenyltransferases: identification of regular C3-prenylated hexahydropyrrolo[2,3-b]indoles as side products of the regular C2-prenyltransferase FtmPT1
CloQ, a prenyltransferase involved in clorobiocin biosynthesis
Identification of the Verruculogen Prenyltransferase FtmPT3 by a Combination of Chemical, Bioinformatic and Biochemical Approaches
New Insights into the Biosynthesis of Prenylated Xanthones: Xptb from Aspergillus nidulans Catalyses an O-Prenylation of Xanthones
Tryptophan prenyltransferases showing higher catalytic activities for Friedel-Crafts alkylation of o- and m-tyrosines than tyrosine prenyltransferases
Multisite Prenylation of 4-Substituted Tryptophans by Dimethylallyltryptophan Synthase
Prenylation of a Nonaromatic Carbon of Indolylbutenone by a Fungal Indole Prenyltransferase
Tryptophan Aminopeptidase Activity of Several Indole Prenyltransferases from Aspergillus fumigatus
AstPT catalyses both reverse N1- and regular C2 Prenylation of a mthylated bisindolyl Benzoquinone
Overproduction. purification and characterization of FgaPT2, a dimethylallyltryptophan synthase from Aspergillus fumigatus
A 7-dimethylallyltryptophan synthase from Aspergillus fumigatus: overproduction, purification and biochemical characterization
A tyrosine O-prenyltransferase catalyses the first pathway-specific step in the biosynthesis of sirodesmin PL
Increasing structure diversity of prenylated diketopiperazine derivates by using a 4-dimethylallyltryptophan synthase
Production of diprenylated indole derivates by tandem incubation of two recombinant dimethylallyltryptophan synthases
Genome mining of ascomycetous fungi reveals their genetic potential for ergot alkaloid production
Ergot alkaloid biosynthesis in Aspergillus fumigatus. Overproduction and biochemical characterization of a 4-dimethylallyltryptophan N-methyltransferase
Acetylaszonalenin biosynthesis in Neosartorya fischeri. Identification of the biosynthetic gene cluster by genomic mining and functional proof of the genes by biochemical investigation
A New Group of Aromatic Prenyltransferases in Fungi,Catalyzing a 2,7-Dihydroxynaphthalene 3-Dimethylallyl-transferase Reaction
Functional characterization of the promiscuous prenyltransferase responsible for furaquinocin biosynthesis: identification of a physiological polyketide substrate and its prenylated reaction products
Biochemical characterization of indole prenyltransferases: filling the last gap of prenylation positions by a 5-dimethylallyltryptophan synthase from Aspergillus clavatus
Site-directed mutagenesis switching a dimethylallyl tryptophan synthase to a specific tyrosine C3-prenylating enzyme
Tryptophan C5-, C6- and C7-Prenylating Enzymes Displaying a Preference for C-6 of the Indole Ring in the Presence of Unnatural Dimethylallyl Diphosphate Analogues
Substrate and catalytic promiscuity of secondary metabolite enzymes: O-prenylation of hydroxanthone with different prenyl donors by bisinolyl benzoquinone C- and N-prenyltransferase
Friedel-Crafts alkylation on indolocarbazoles catalyzed by two dimethylallyltryptophan synthases from Aspergillus
Pranylation of tyrosine and derivatives by a tryptophan C7-prenyltransferase
Biosynthetic Pathways of Ergot Alkaloids
Reverse prenyltransferase in the biosynthesis of fumigaclavine C in Aspergillus fumigatus: gene expression, purification, and characterization of fumigaclavine C synthase FGAPT1
Stereospecific synthesis of aszonalenins by using two recombinant prenyltransferases
Prenyl transfer to aromatic substrates in the biosynthesis of aminocoumarins, meroterpenoids and phenazines: the ABBA prenyltransferase family
Substrate Promiscuity of the Cyclic Dipeptide Prenyltransferases from Aspergillus fumigatus
Production of novel antioxidative prenyl naphthalen-ols by combinational bioconversion with dioxygenase PhnA1A2A3A4 and prenyltransferase NphB or SCO7190
Complementary Flavonoid Prenylations by Fungal Indole Prenyltransferases
Potential of a 7-dimethylallyltryptophan synthase as a tool for production of prenylated indole derivatives
Chemoenzymatic synthesis of prenylated indole derivatives by using a 4-dimethylallyltryptophan synthase from Aspergillus fumigatus
Preparation of pyrrolo[2,3-b]indoles carrying a beta-configured reverse C3-dimethylallyl moiety by using a recombinant prenyltransferase CdpC3PT
Simultaneous C7- and N1-prenylation of cyclo-L-Trp-L-Trp catalyzed by a prenyltransferase from Aspergillus oryzae
The tyrosine O-prenyltransferase SirD catalyzes O-, N-, and C-prenylations
Substrate promiscuity of secondary metabolite enzymes: prenylation of hydroxynaphthalenes by fungal indole prenyltransferases
Identification of a brevianamide F reverse prenyltransferase BrePT from Aspergillus versicolor with a broad substrate specificity towards tryptophan-containing cyclic dipeptides
A promiscuous prenyltransferase from Aspergillus oryzae catalyses C-prenylations of hydroxynaphthalenes in the presence of different prenyl donors
C7-prenylation of tryptophanyl and O-Prenylation of tyrosyl residues in dipeptides by an aspergillus terreus prenytransferase
Targeted production of secondary metabolites by coexpression of non-ribosomal peptide synthetase and prenyltransferase genes in Aspergillus
Tyrosine O-Prenyltransferases TyrPT and SirD displaying similar behavior unnatural or benzyl disphosphate as their natural prenyl donor dimethyallyl diphosphate
Description
Tryptophan dimethylallyltransferase 4-dimethylallyltryptophan synthase All-trans-hexaprenyl-diphosphate synthase L-tryptophan dimethylallyl transferase
Entry type
Back to top