Curate Enzyme PTDBENZ00003

---

Name*

Organism*

Protein sequence

>sp|Q8GHB2|CLOQ_STRRC 4-hydroxyphenylpyruvate 3-dimethylallyltransferase OS=Streptomyces roseochromogenus subsp. oscitans GN=cloQ PE=1 SV=1 MPALPIDQEFDCERFRADIRATAAAIGAPIAHRLTDTVLEAFRDNFAQGATLWKTTSQPG DQLSYRFFSRLKMDTVSRAIDAGLLDAAHPTLAVVDAWSSLYGGAPVQSGDFDAGRGMAK TWLYFGGLRPAEDILTVPALPASVQARLKDFLALGLAHVRFAAVDWRHHSANVYFRGKGP LDTVQFARIHALSGSTPPAAHVVEEVLAYMPEDYCVAITLDLHSGDIERVCFYALKVPKN ALPRIPTRIARFLEVAPSHDVEECNVIGWSFGRSGDYVKAERSYTGNMAEILAGWNCFFH GEEGRDHDLRALHQHTESTMGGAR

UNIPROTKB

Gene*

PDB codes

Reference*

- Breaking the regioselectivity of indole prenyltransferases: identification of regular C3-prenylated hexahydropyrrolo[2,3-b]indoles as side products of the regular C2-prenyltransferase FtmPT1 CloQ, a prenyltransferase involved in clorobiocin biosynthesis Identification of the Verruculogen Prenyltransferase FtmPT3 by a Combination of Chemical, Bioinformatic and Biochemical Approaches New Insights into the Biosynthesis of Prenylated Xanthones: Xptb from Aspergillus nidulans Catalyses an O-Prenylation of Xanthones Tryptophan prenyltransferases showing higher catalytic activities for Friedel-Crafts alkylation of o- and m-tyrosines than tyrosine prenyltransferases Multisite Prenylation of 4-Substituted Tryptophans by Dimethylallyltryptophan Synthase Prenylation of a Nonaromatic Carbon of Indolylbutenone by a Fungal Indole Prenyltransferase Tryptophan Aminopeptidase Activity of Several Indole Prenyltransferases from Aspergillus fumigatus AstPT catalyses both reverse N1- and regular C2 Prenylation of a mthylated bisindolyl Benzoquinone Overproduction. purification and characterization of FgaPT2, a dimethylallyltryptophan synthase from Aspergillus fumigatus A 7-dimethylallyltryptophan synthase from Aspergillus fumigatus: overproduction, purification and biochemical characterization A tyrosine O-prenyltransferase catalyses the first pathway-specific step in the biosynthesis of sirodesmin PL Increasing structure diversity of prenylated diketopiperazine derivates by using a 4-dimethylallyltryptophan synthase Production of diprenylated indole derivates by tandem incubation of two recombinant dimethylallyltryptophan synthases Genome mining of ascomycetous fungi reveals their genetic potential for ergot alkaloid production Ergot alkaloid biosynthesis in Aspergillus fumigatus. Overproduction and biochemical characterization of a 4-dimethylallyltryptophan N-methyltransferase Acetylaszonalenin biosynthesis in Neosartorya fischeri. Identification of the biosynthetic gene cluster by genomic mining and functional proof of the genes by biochemical investigation A New Group of Aromatic Prenyltransferases in Fungi,Catalyzing a 2,7-Dihydroxynaphthalene 3-Dimethylallyl-transferase Reaction Functional characterization of the promiscuous prenyltransferase responsible for furaquinocin biosynthesis: identification of a physiological polyketide substrate and its prenylated reaction products Biochemical characterization of indole prenyltransferases: filling the last gap of prenylation positions by a 5-dimethylallyltryptophan synthase from Aspergillus clavatus Site-directed mutagenesis switching a dimethylallyl tryptophan synthase to a specific tyrosine C3-prenylating enzyme Tryptophan C5-, C6- and C7-Prenylating Enzymes Displaying a Preference for C-6 of the Indole Ring in the Presence of Unnatural Dimethylallyl Diphosphate Analogues Substrate and catalytic promiscuity of secondary metabolite enzymes: O-prenylation of hydroxanthone with different prenyl donors by bisinolyl benzoquinone C- and N-prenyltransferase Friedel-Crafts alkylation on indolocarbazoles catalyzed by two dimethylallyltryptophan synthases from Aspergillus Pranylation of tyrosine and derivatives by a tryptophan C7-prenyltransferase Biosynthetic Pathways of Ergot Alkaloids Reverse prenyltransferase in the biosynthesis of fumigaclavine C in Aspergillus fumigatus: gene expression, purification, and characterization of fumigaclavine C synthase FGAPT1 Stereospecific synthesis of aszonalenins by using two recombinant prenyltransferases Prenyl transfer to aromatic substrates in the biosynthesis of aminocoumarins, meroterpenoids and phenazines: the ABBA prenyltransferase family Substrate Promiscuity of the Cyclic Dipeptide Prenyltransferases from Aspergillus fumigatus Production of novel antioxidative prenyl naphthalen-ols by combinational bioconversion with dioxygenase PhnA1A2A3A4 and prenyltransferase NphB or SCO7190 Complementary Flavonoid Prenylations by Fungal Indole Prenyltransferases Potential of a 7-dimethylallyltryptophan synthase as a tool for production of prenylated indole derivatives Chemoenzymatic synthesis of prenylated indole derivatives by using a 4-dimethylallyltryptophan synthase from Aspergillus fumigatus Preparation of pyrrolo[2,3-b]indoles carrying a beta-configured reverse C3-dimethylallyl moiety by using a recombinant prenyltransferase CdpC3PT Simultaneous C7- and N1-prenylation of cyclo-L-Trp-L-Trp catalyzed by a prenyltransferase from Aspergillus oryzae The tyrosine O-prenyltransferase SirD catalyzes O-, N-, and C-prenylations Substrate promiscuity of secondary metabolite enzymes: prenylation of hydroxynaphthalenes by fungal indole prenyltransferases Identification of a brevianamide F reverse prenyltransferase BrePT from Aspergillus versicolor with a broad substrate specificity towards tryptophan-containing cyclic dipeptides A promiscuous prenyltransferase from Aspergillus oryzae catalyses C-prenylations of hydroxynaphthalenes in the presence of different prenyl donors C7-prenylation of tryptophanyl and O-Prenylation of tyrosyl residues in dipeptides by an aspergillus terreus prenytransferase Targeted production of secondary metabolites by coexpression of non-ribosomal peptide synthetase and prenyltransferase genes in Aspergillus Tyrosine O-Prenyltransferases TyrPT and SirD displaying similar behavior unnatural or benzyl disphosphate as their natural prenyl donor dimethyallyl diphosphate

Description

4-hydroxyphenylpyruvate 3-dimethylallyltransferase 4HPP 3-dimethylallyltransferase Aromatic prenyltransferase CloQ Clorobiocin biosynthesis protein Q

Entry type